PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0498s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 258aa    MW: 28331.5 Da    PI: 8.9333
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0498s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.39.6e-403394263
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                            k++al+cprC stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  SapurV1A.0498s0050.1.p 33 KDQALNCPRCTSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 94
                            7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-272585IPR003851Zinc finger, Dof-type
PfamPF027018.5E-343491IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0223791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MDETPTQWPQ GINGVVKSME GPDMLERRAR PQKDQALNCP RCTSTNTKFC YYNNYSLSQP  60
RYFCKTCRRY WTEGGSLRNV PVGGGSRKNK RSSSNPSSSA AVAAEKKFPL DLTQANFPQS  120
ATQNPKIHEG PDLNLAYPPS HISAMELLKS AGMSPRGFNA FMSIPAASDS NNMFSTGFPL  180
QEFKPSTQNF SLEGFESGYS NIQGVHDQSR SGARLLFPIE DLKQQVPSNS SGFERNTRGQ  240
GDSALGYWNG MLGGESW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4028440.0FJ402844.1 Populus tomentosa Dof1 (Dof1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321982.11e-155hypothetical protein POPTR_0015s01160g
TrEMBLB9IDM41e-155B9IDM4_POPTR; Uncharacterized protein
STRINGPOPTR_0015s01160.11e-154(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.36e-47Dof family protein